Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d4no1p_: 4no1 P: [236924] Other proteins in same PDB: d4no1a_, d4no1c2, d4no1e_, d4no1f_, d4no1i_, d4no1j_, d4no1k_, d4no1l_, d4no1n_, d4no1o_, d4no1q2, d4no1s_, d4no1t_, d4no1w_, d4no1x_, d4no1y_, d4no1z_ automated match to d2zcyb_ complexed with cix, mg |
PDB Entry: 4no1 (more details), 2.5 Å
SCOPe Domain Sequences for d4no1p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4no1p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4no1p_:
View in 3D Domains from other chains: (mouse over for more information) d4no1a_, d4no1b_, d4no1c1, d4no1c2, d4no1d_, d4no1e_, d4no1f_, d4no1g_, d4no1h_, d4no1i_, d4no1j_, d4no1k_, d4no1l_, d4no1m_, d4no1n_, d4no1o_, d4no1q1, d4no1q2, d4no1r_, d4no1s_, d4no1t_, d4no1u_, d4no1v_, d4no1w_, d4no1x_, d4no1y_, d4no1z_ |