Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d4no9b_: 4no9 B: [236889] Other proteins in same PDB: d4no9a_, d4no9c2, d4no9e_, d4no9f_, d4no9i_, d4no9j_, d4no9k_, d4no9l_, d4no9n_, d4no9o_, d4no9q2, d4no9s_, d4no9t_, d4no9w_, d4no9x_, d4no9y_, d4no9z_ automated match to d2zcyb_ complexed with 2l0, 2lr, mg |
PDB Entry: 4no9 (more details), 2.9 Å
SCOPe Domain Sequences for d4no9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4no9b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4no9b_:
View in 3D Domains from other chains: (mouse over for more information) d4no9a_, d4no9c1, d4no9c2, d4no9d_, d4no9e_, d4no9f_, d4no9g_, d4no9h_, d4no9i_, d4no9j_, d4no9k_, d4no9l_, d4no9m_, d4no9n_, d4no9o_, d4no9p_, d4no9q1, d4no9q2, d4no9r_, d4no9s_, d4no9t_, d4no9u_, d4no9v_, d4no9w_, d4no9x_, d4no9y_, d4no9z_ |