Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d4no8v_: 4no8 V: [236882] Other proteins in same PDB: d4no8a_, d4no8e_, d4no8f_, d4no8i_, d4no8j_, d4no8k_, d4no8l_, d4no8n_, d4no8o_, d4no8s_, d4no8t_, d4no8w_, d4no8x_, d4no8y_, d4no8z_ automated match to d2zcyh_ complexed with 2lv, mg |
PDB Entry: 4no8 (more details), 2.7 Å
SCOPe Domain Sequences for d4no8v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4no8v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4no8v_: