Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries) |
Domain d4nnwv_: 4nnw V: [236860] Other proteins in same PDB: d4nnwa_, d4nnwe_, d4nnwf_, d4nnwi_, d4nnwj_, d4nnwk_, d4nnwl_, d4nnwn_, d4nnwo_, d4nnws_, d4nnwt_, d4nnww_, d4nnwx_, d4nnwy_, d4nnwz_ automated match to d2zcyh_ complexed with 2mk, mg |
PDB Entry: 4nnw (more details), 2.6 Å
SCOPe Domain Sequences for d4nnwv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nnwv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4nnwv_: