SCOPe 2.08: Domain d4nnwp_: 4nnw P:

Lineage for d4nnwp_ (4nnw P:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d4nnwp_: 4nnw P: [236856]
   Other proteins in same PDB: d4nnwa_, d4nnwc2, d4nnwe_, d4nnwf_, d4nnwi_, d4nnwj_, d4nnwk_, d4nnwl_, d4nnwn_, d4nnwo_, d4nnwq2, d4nnws_, d4nnwt_, d4nnww_, d4nnwx_, d4nnwy_, d4nnwz_
   automated match to d2zcyb_
   complexed with 2mk, mg

Details for d4nnwp_

PDB Entry: 4nnw, 2.6 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-ketoaldehyde

PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4nnwp_:

Sequence; same for both SEQRES and ATOM records:

>d4nnwp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4nnwp_:

• d4nnwp_ first appeared in SCOPe 2.03
  
• d4nnwp_ appears in SCOPe 2.07