Lineage for d4nnwu_ (4nnw U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2552858Domain d4nnwu_: 4nnw U: [236853]
    Other proteins in same PDB: d4nnwa_, d4nnwe_, d4nnwf_, d4nnwi_, d4nnwj_, d4nnwk_, d4nnwl_, d4nnwn_, d4nnwo_, d4nnws_, d4nnwt_, d4nnww_, d4nnwx_, d4nnwy_, d4nnwz_
    automated match to d2zcyg_
    complexed with 2mk, mg

Details for d4nnwu_

PDB Entry: 4nnw (more details), 2.6 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-ketoaldehyde
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4nnwu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnwu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4nnwu_:

Click to download the PDB-style file with coordinates for d4nnwu_.
(The format of our PDB-style files is described here.)

Timeline for d4nnwu_: