Lineage for d4nnnx_ (4nnn X:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (199 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2551569Domain d4nnnx_: 4nnn X: [236838]
    Other proteins in same PDB: d4nnnb_, d4nnnc_, d4nnnd_, d4nnne_, d4nnnf_, d4nnng_, d4nnnh_, d4nnnm_, d4nnnp_, d4nnnq_, d4nnnr_, d4nnns_, d4nnnt_, d4nnnu_, d4nnnv_
    automated match to d1rypk_
    complexed with ald, mg

Details for d4nnnx_

PDB Entry: 4nnn (more details), 2.5 Å

PDB Description: yCP in complex with MG132
PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4nnnx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnnx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d4nnnx_:

Click to download the PDB-style file with coordinates for d4nnnx_.
(The format of our PDB-style files is described here.)

Timeline for d4nnnx_: