Lineage for d4nnnw_ (4nnn W:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1438333Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1438342Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438960Domain d4nnnw_: 4nnn W: [236835]
    Other proteins in same PDB: d4nnnb_, d4nnnc_, d4nnnd_, d4nnne_, d4nnng_, d4nnnh_, d4nnnm_, d4nnnp_, d4nnnq_, d4nnnr_, d4nnns_, d4nnnu_, d4nnnv_
    automated match to d1g0ui_
    complexed with ald, mg

Details for d4nnnw_

PDB Entry: 4nnn (more details), 2.5 Å

PDB Description: yCP in complex with MG132
PDB Compounds: (W:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d4nnnw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnnw_ d.153.1.4 (W:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d4nnnw_:

Click to download the PDB-style file with coordinates for d4nnnw_.
(The format of our PDB-style files is described here.)

Timeline for d4nnnw_: