Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries) |
Domain d4nnnh_: 4nnn H: [236827] Other proteins in same PDB: d4nnna_, d4nnne_, d4nnnf_, d4nnni_, d4nnnj_, d4nnnk_, d4nnnl_, d4nnnn_, d4nnno_, d4nnns_, d4nnnt_, d4nnnw_, d4nnnx_, d4nnny_, d4nnnz_ automated match to d2zcyh_ complexed with ald, mg |
PDB Entry: 4nnn (more details), 2.5 Å
SCOPe Domain Sequences for d4nnnh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nnnh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4nnnh_: