Lineage for d4nnnh_ (4nnn H:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2552896Domain d4nnnh_: 4nnn H: [236827]
    Other proteins in same PDB: d4nnna_, d4nnne_, d4nnnf_, d4nnni_, d4nnnj_, d4nnnk_, d4nnnl_, d4nnnn_, d4nnno_, d4nnns_, d4nnnt_, d4nnnw_, d4nnnx_, d4nnny_, d4nnnz_
    automated match to d2zcyh_
    complexed with ald, mg

Details for d4nnnh_

PDB Entry: 4nnn (more details), 2.5 Å

PDB Description: yCP in complex with MG132
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4nnnh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnnh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4nnnh_:

Click to download the PDB-style file with coordinates for d4nnnh_.
(The format of our PDB-style files is described here.)

Timeline for d4nnnh_: