Lineage for d4n8db1 (4n8d B:40-508)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327543Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1327637Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 1327638Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 1327841Protein automated matches [226889] (2 species)
    not a true protein
  7. 1327842Species Human (Homo sapiens) [TaxId:9606] [225823] (13 PDB entries)
  8. 1327846Domain d4n8db1: 4n8d B:40-508 [236806]
    Other proteins in same PDB: d4n8da2, d4n8db2
    automated match to d4a5sb1
    complexed with 2ks, nag, so4

Details for d4n8db1

PDB Entry: 4n8d (more details), 1.65 Å

PDB Description: DPP4 complexed with syn-7aa
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4n8db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8db1 b.70.3.1 (B:40-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlidytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d4n8db1:

Click to download the PDB-style file with coordinates for d4n8db1.
(The format of our PDB-style files is described here.)

Timeline for d4n8db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n8db2