Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries) |
Domain d4n8eb2: 4n8e B:509-766 [236803] Other proteins in same PDB: d4n8ea1, d4n8eb1, d4n8eb3 automated match to d4a5sb2 complexed with 2kv, nag, so4 |
PDB Entry: 4n8e (more details), 2.3 Å
SCOPe Domain Sequences for d4n8eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n8eb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d4n8eb2: