Lineage for d4n8eb2 (4n8e B:509-766)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152916Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)
  8. 2152984Domain d4n8eb2: 4n8e B:509-766 [236803]
    Other proteins in same PDB: d4n8ea1, d4n8eb1, d4n8eb3
    automated match to d4a5sb2
    complexed with 2kv, nag, so4

Details for d4n8eb2

PDB Entry: 4n8e (more details), 2.3 Å

PDB Description: dpp4 complexed with compound 12a
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4n8eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8eb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d4n8eb2:

Click to download the PDB-style file with coordinates for d4n8eb2.
(The format of our PDB-style files is described here.)

Timeline for d4n8eb2: