SCOPe 2.04: Domain d4n8ea1: 4n8e A:40-508

Lineage for d4n8ea1 (4n8e A:40-508)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (81 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d4n8ea1: 4n8e A:40-508 [236800]
   Other proteins in same PDB: d4n8ea2, d4n8eb2
   automated match to d4a5sa1
   complexed with 2kv, nag, so4

Details for d4n8ea1

PDB Entry: 4n8e, 2.3 Å

PDB Description: dpp4 complexed with compound 12a

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4n8ea1:

Sequence; same for both SEQRES and ATOM records:

>d4n8ea1 b.70.3.1 (A:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlidytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d4n8ea1:

• d4n8ea1 first appeared in SCOPe 2.03
  
• d4n8ea1 appears in SCOPe 2.05
  
• d4n8ea1 appears in the current release, SCOPe 2.08