Lineage for d4n09d_ (4n09 D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385058Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1385059Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1385284Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1385285Protein automated matches [190117] (34 species)
    not a true protein
  7. 1385500Species Trypanosoma brucei [TaxId:999953] [236068] (2 PDB entries)
  8. 1385505Domain d4n09d_: 4n09 D: [236795]
    automated match to d4n08a_
    complexed with adn, adp, edo

Details for d4n09d_

PDB Entry: 4n09 (more details), 2.6 Å

PDB Description: Structure of Trypanosoma brucei brucei adenosine kinase in complex with adenosine and AMPPNP
PDB Compounds: (D:) adenosine kinase

SCOPe Domain Sequences for d4n09d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n09d_ c.72.1.0 (D:) automated matches {Trypanosoma brucei [TaxId: 999953]}
saplrvyvqcnplldvsahvsdeflvkyglergtaillserqkgifddiekmpnvryvpg
gsglnvarvaqwmqqaykgkfvtyvgciaddrygkvlkeaaehegivmavehttkagsga
cavcitgkertlvadlgaanhlssehmrspavvramdesrifyfsgftltvdvnhvlqac
rkarevdglfminlsapfimqffsaqlgevlpytdiivanrheakefanmmkwdtdcvee
iarravsevpytgtkgrvvvftrdiestvlatkdgvetvpvpqldqdkvidmngagdafm
ggflsayavgkdlrrccetghytaqeviqrdgcsfpekpsfs

SCOPe Domain Coordinates for d4n09d_:

Click to download the PDB-style file with coordinates for d4n09d_.
(The format of our PDB-style files is described here.)

Timeline for d4n09d_: