Lineage for d4ludb2 (4lud B:147-249)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1424635Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1424864Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 1424865Species Human (Homo sapiens) [TaxId:9606] [55566] (17 PDB entries)
  8. 1424894Domain d4ludb2: 4lud B:147-249 [236785]
    Other proteins in same PDB: d4luda1, d4luda3, d4ludb1, d4ludb3
    automated match to d1qcfa2
    complexed with ca, cl, gol, sk8

Details for d4ludb2

PDB Entry: 4lud (more details), 2.85 Å

PDB Description: crystal structure of hck in complex with the fluorescent compound skf86002
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4ludb2:

Sequence, based on SEQRES records: (download)

>d4ludb2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Sequence, based on observed residues (ATOM records): (download)

>d4ludb2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsetsyslsvrdydprqgdtvkhykitlqe
lvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d4ludb2:

Click to download the PDB-style file with coordinates for d4ludb2.
(The format of our PDB-style files is described here.)

Timeline for d4ludb2: