SCOPe 2.04: Domain d4lega_: 4leg A:

Lineage for d4lega_ (4leg A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)

8. Domain d4lega_: 4leg A: [236776]
   automated match to d3of8a_
   complexed with 1xf, act, gol, so4; mutant

Details for d4lega_

PDB Entry: 4leg, 2.6 Å

PDB Description: human cathepsin k mutant c25s in complex with an allosteric modifier

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d4lega_:

Sequence; same for both SEQRES and ATOM records:

>d4lega_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d4lega_:

• d4lega_ first appeared in SCOPe 2.03
  
• d4lega_ appears in SCOPe 2.05
  
• d4lega_ last appears in SCOPe 2.06