Lineage for d3l3va_ (3l3v A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374020Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1374021Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 1374022Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (37 PDB entries)
  8. 1374092Domain d3l3va_: 3l3v A: [236772]
    automated match to d3ao1b_
    protein/DNA complex; complexed with cd, so4, suc

Details for d3l3va_

PDB Entry: 3l3v (more details)

PDB Description: structure of hiv-1 integrase core domain in complex with sucrose
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d3l3va_:

Sequence, based on SEQRES records: (download)

>d3l3va_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d3l3va_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipesmnkelkkiigqvrdqaehlktavqmavfihn
hkrkggiggysagerivdiiatdi

SCOPe Domain Coordinates for d3l3va_:

Click to download the PDB-style file with coordinates for d3l3va_.
(The format of our PDB-style files is described here.)

Timeline for d3l3va_: