Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (40 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [236718] (2 PDB entries) |
Domain d4io0b_: 4io0 B: [236723] automated match to d1cqwa_ complexed with rn1, so4; mutant |
PDB Entry: 4io0 (more details), 2.9 Å
SCOPe Domain Sequences for d4io0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4io0b_ c.69.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]} qyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynlsek psglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliafngp hpytamrelrtnknqqkaseymkwfqkqevqdymerdnfsglrklvidpgvkkgyltadd vqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdptfm penldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk
Timeline for d4io0b_: