SCOPe 2.03: Domain d4inza_: 4inz A:

Lineage for d4inza_ (4inz A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (40 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [236718] (2 PDB entries)

8. Domain d4inza_: 4inz A: [236720]
   automated match to d1cqwa_
   complexed with edo, peg; mutant

Details for d4inza_

PDB Entry: 4inz, 1.7 Å

PDB Description: The crystal structure of M145A mutant of an epoxide hydrolase from Bacillus megaterium

PDB Compounds: (A:) Soluble epoxide hydrolase

SCOPe Domain Sequences for d4inza_:

Sequence; same for both SEQRES and ATOM records:

>d4inza_ c.69.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
skqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynls
ekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliafn
gphpytfmrelrtnknqqkaseyakwfqkqevqdymerdnfsglrklvidpgvkkgylta
ddvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdpt
fmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk

Timeline for d4inza_:

• d4inza_ is new in SCOPe 2.03-stable
  
• d4inza_ appears in SCOPe 2.04
  
• d4inza_ appears in the current release, SCOPe 2.08