Lineage for d3g2ca1 (3g2c A:2-257)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988263Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)
  8. 2988275Domain d3g2ca1: 3g2c A:2-257 [236709]
    Other proteins in same PDB: d3g2ca2
    automated match to d3fzia_
    protein/DNA complex; complexed with gol, mg, po4

Details for d3g2ca1

PDB Entry: 3g2c (more details), 2.3 Å

PDB Description: mth0212 in complex with a short ssdna (cgta)
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g2ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g2ca1 d.151.1.0 (A:2-257) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleiel

SCOPe Domain Coordinates for d3g2ca1:

Click to download the PDB-style file with coordinates for d3g2ca1.
(The format of our PDB-style files is described here.)

Timeline for d3g2ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g2ca2
View in 3D
Domains from other chains:
(mouse over for more information)
d3g2cb_