Lineage for d3g0rb_ (3g0r B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224511Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2224512Protein automated matches [190734] (12 species)
    not a true protein
  7. 2224520Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)
  8. 2224532Domain d3g0rb_: 3g0r B: [236706]
    automated match to d3g00a_
    protein/DNA complex; complexed with gol, na, pg4

Details for d3g0rb_

PDB Entry: 3g0r (more details), 2.4 Å

PDB Description: complex of mth0212 and an 8bp dsdna with distorted ends
PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0rb_ d.151.1.0 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp
aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl
kyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawid
kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd
vmgsdhcpigleie

SCOPe Domain Coordinates for d3g0rb_:

Click to download the PDB-style file with coordinates for d3g0rb_.
(The format of our PDB-style files is described here.)

Timeline for d3g0rb_: