Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
Protein automated matches [190734] (12 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries) |
Domain d3g0rb_: 3g0r B: [236706] automated match to d3g00a_ protein/DNA complex; complexed with gol, na, pg4 |
PDB Entry: 3g0r (more details), 2.4 Å
SCOPe Domain Sequences for d3g0rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g0rb_ d.151.1.0 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl kyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawid kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd vmgsdhcpigleie
Timeline for d3g0rb_: