Lineage for d4kt0e_ (4kt0 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310597Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 1310611Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (1 protein)
    automatically mapped to Pfam PF02427
  6. 1310612Protein Photosystem I accessory protein E (PsaE) [50095] (4 species)
  7. 1310621Species Synechocystis sp. PCC 6803 [TaxId:1148] [89302] (2 PDB entries)
  8. 1310622Domain d4kt0e_: 4kt0 E: [236684]
    Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0d_, d4kt0f_, d4kt0j_
    automated match to d1gxie_
    complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4

Details for d4kt0e_

PDB Entry: 4kt0 (more details), 2.8 Å

PDB Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
PDB Compounds: (E:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d4kt0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kt0e_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Synechocystis sp. PCC 6803 [TaxId: 1148]}
alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
aenelelv

SCOPe Domain Coordinates for d4kt0e_:

Click to download the PDB-style file with coordinates for d4kt0e_.
(The format of our PDB-style files is described here.)

Timeline for d4kt0e_: