Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (1 protein) automatically mapped to Pfam PF02427 |
Protein Photosystem I accessory protein E (PsaE) [50095] (4 species) |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [89302] (2 PDB entries) |
Domain d4kt0e_: 4kt0 E: [236684] Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0d_, d4kt0f_, d4kt0j_ automated match to d1gxie_ complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4 |
PDB Entry: 4kt0 (more details), 2.8 Å
SCOPe Domain Sequences for d4kt0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kt0e_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Synechocystis sp. PCC 6803 [TaxId: 1148]} alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf aenelelv
Timeline for d4kt0e_: