Lineage for d3zlhb2 (3zlh B:140-433)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837793Species Streptococcus pyogenes [TaxId:286636] [236667] (3 PDB entries)
  8. 2837803Domain d3zlhb2: 3zlh B:140-433 [236678]
    Other proteins in same PDB: d3zlha1, d3zlha3, d3zlhb1, d3zlhb3, d3zlhc1, d3zlhc3, d3zlhd1, d3zlhd3
    automated match to d1onea1

Details for d3zlhb2

PDB Entry: 3zlh (more details), 2.9 Å

PDB Description: structure of group a streptococcal enolase
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d3zlhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zlhb2 c.1.11.0 (B:140-433) automated matches {Streptococcus pyogenes [TaxId: 286636]}
kvlptpmmniinggshsdapiafqefmimpvgaptfkeglrwgaevfhalkkilkerglv
tavgdeggfapkfegtedgvetilkaieaagyeagengimigfdcassefydkerkvydy
tkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwdgwkvlterlgkrvqlvgd
dffvtnteylargikenaansilikvnqigtltetfeaiemakeagytavvshrsgeted
stiadiavatnagqiktgslsrtdriakynqllriedqlgevaqykgiksfynl

SCOPe Domain Coordinates for d3zlhb2:

Click to download the PDB-style file with coordinates for d3zlhb2.
(The format of our PDB-style files is described here.)

Timeline for d3zlhb2: