Lineage for d3zlhb1 (3zlh B:1-139)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192189Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)
  8. 2192199Domain d3zlhb1: 3zlh B:1-139 [236677]
    Other proteins in same PDB: d3zlha2, d3zlha3, d3zlhb2, d3zlhb3, d3zlhc2, d3zlhc3, d3zlhd2, d3zlhd3
    automated match to d1p43a2

Details for d3zlhb1

PDB Entry: 3zlh (more details), 2.9 Å

PDB Description: structure of group a streptococcal enolase
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d3zlhb1:

Sequence, based on SEQRES records: (download)

>d3zlhb1 d.54.1.0 (B:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggfnt

Sequence, based on observed residues (ATOM records): (download)

>d3zlhb1 d.54.1.0 (B:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastheavelrdgdksrylgl
gtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraa
adylevplytylggfnt

SCOPe Domain Coordinates for d3zlhb1:

Click to download the PDB-style file with coordinates for d3zlhb1.
(The format of our PDB-style files is described here.)

Timeline for d3zlhb1: