SCOPe 2.06: Domain d3zlga1: 3zlg A:1-139

Lineage for d3zlga1 (3zlg A:1-139)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)

8. Domain d3zlga1: 3zlg A:1-139 [236675]
   Other proteins in same PDB: d3zlga2, d3zlgb2, d3zlgc2, d3zlgd2
   automated match to d1p43a2
   complexed with po4; mutant

Details for d3zlga1

PDB Entry: 3zlg, 2.1 Å

PDB Description: structure of group a streptococcal enolase k362a mutant

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d3zlga1:

Sequence; same for both SEQRES and ATOM records:

>d3zlga1 d.54.1.0 (A:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggfnt

Timeline for d3zlga1:

• d3zlga1 first appeared in SCOPe 2.03
  
• d3zlga1 appears in SCOPe 2.05
  
• d3zlga1 appears in SCOPe 2.07
  
• d3zlga1 appears in the current release, SCOPe 2.08