SCOPe 2.06: Domain d3weab_: 3wea B:

Lineage for d3weab_ (3wea B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Camponotus japonicus [TaxId:84547] [236657] (2 PDB entries)

8. Domain d3weab_: 3wea B: [236658]
   automated match to d1nepa_

Details for d3weab_

PDB Entry: 3wea, 1.8 Å

PDB Description: crystal structure of a niemann-pick type c2 protein from japanese carpenter ant

PDB Compounds: (B:) Niemann-Pick type C2 protein

SCOPe Domain Sequences for d3weab_:

Sequence; same for both SEQRES and ATOM records:

>d3weab_ b.1.18.0 (B:) automated matches {Camponotus japonicus [TaxId: 84547]}
fvfedcgsevgkfsdiiisscdpseekcsiireseihvsmkftpsvdvknveakafgvll
dvpvpfplkkpeickdpdsgvkcplkkdveieykvtffvekatpalsleimwefrnekde
kitcvkfpakik

Timeline for d3weab_:

• d3weab_ first appeared in SCOPe 2.03
  
• d3weab_ appears in SCOPe 2.05
  
• d3weab_ appears in SCOPe 2.07
  
• d3weab_ appears in the current release, SCOPe 2.08