SCOPe 2.05: Domain d3w2cg_: 3w2c G:

Lineage for d3w2cg_ (3w2c G:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
   OPK group; AIRK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [90039] (46 PDB entries)

8. Domain d3w2cg_: 3w2c G: [236653]
   automated match to d1ol5a_
   complexed with n15

Details for d3w2cg_

PDB Entry: 3w2c, 2.45 Å

PDB Description: Structure of Aurora kinase A complexed to benzoimidazole-indazole inhibitor XV

PDB Compounds: (G:) Aurora kinase A

SCOPe Domain Sequences for d3w2cg_:

Sequence, based on SEQRES records:

>d3w2cg_ d.144.1.7 (G:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
hskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhd
ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
psqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records):

>d3w2cg_ d.144.1.7 (G:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqeveiqshlrhpnilrlygy
fhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyckpenlllgsage
lkiadtldylppemievdlwslgvlcyeflvgkppfeantyqykrisrveftfpdfvteg
ardlisrllkhnphpwitanss

Timeline for d3w2cg_:

• d3w2cg_ first appeared in SCOPe 2.03
  
• d3w2cg_ appears in SCOPe 2.04
  
• d3w2cg_ appears in SCOPe 2.06
  
• d3w2cg_ appears in the current release, SCOPe 2.08