SCOPe 2.05: Domain d4ohjb2: 4ohj B:134-236

Lineage for d4ohjb2 (4ohj B:134-236)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein automated matches [226944] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225595] (2 PDB entries)

8. Domain d4ohjb2: 4ohj B:134-236 [236650]
   Other proteins in same PDB: d4ohja1, d4ohjb1
   automated match to d1aw7a2

Details for d4ohjb2

PDB Entry: 4ohj, 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus

PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohjb2:

Sequence; same for both SEQRES and ATOM records:

>d4ohjb2 d.15.6.1 (B:134-236) automated matches {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkygpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaeinge

Timeline for d4ohjb2:

• d4ohjb2 first appeared in SCOPe 2.03
  
• d4ohjb2 appears in SCOPe 2.04
  
• d4ohjb2 appears in SCOPe 2.06
  
• d4ohjb2 appears in the current release, SCOPe 2.08