Lineage for d4n7km_ (4n7k M:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698958Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1698959Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1698960Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1699045Protein M (medium) subunit [81481] (3 species)
  7. 1699046Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 1699103Domain d4n7km_: 4n7k M: [236617]
    Other proteins in same PDB: d4n7kh1, d4n7kh2, d4n7kl_
    automated match to d2j8dm_
    complexed with 2go, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10

Details for d4n7km_

PDB Entry: 4n7k (more details), 2.85 Å

PDB Description: Zinc Substituted Reaction Center of the Rhodobacter sphaeroides
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d4n7km_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n7km_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

SCOPe Domain Coordinates for d4n7km_:

Click to download the PDB-style file with coordinates for d4n7km_.
(The format of our PDB-style files is described here.)

Timeline for d4n7km_: