Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (3 PDB entries) |
Domain d4ktdl2: 4ktd L:108-208 [236604] Other proteins in same PDB: d4ktdl1 automated match to d2fb4l2 complexed with gol, so4 |
PDB Entry: 4ktd (more details), 2 Å
SCOPe Domain Sequences for d4ktdl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ktdl2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d4ktdl2: