SCOPe 2.06: Domain d4ll4d_: 4ll4 D:

Lineage for d4ll4d_ (4ll4 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d4ll4d_: 4ll4 D: [236599]
   automated match to d2ifqa_

Details for d4ll4d_

PDB Entry: 4ll4, 2.7 Å

PDB Description: The structure of the TRX and TXNIP complex

PDB Compounds: (D:) thioredoxin

SCOPe Domain Sequences for d4ll4d_:

Sequence; same for both SEQRES and ATOM records:

>d4ll4d_ c.47.1.1 (D:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

Timeline for d4ll4d_:

• d4ll4d_ first appeared in SCOPe 2.03
  
• d4ll4d_ appears in SCOPe 2.05
  
• d4ll4d_ appears in SCOPe 2.07
  
• d4ll4d_ appears in the current release, SCOPe 2.08