Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Malate dehydrogenase [56329] (12 species) |
Species Thermus thermophilus [TaxId:274] [82806] (7 PDB entries) identical sequence to that from the Thermus flavus enzyme |
Domain d4kdfd2: 4kdf D:155-326 [236587] Other proteins in same PDB: d4kdfa1, d4kdfb1, d4kdfc1, d4kdfd1 automated match to d1wzea2 complexed with so4 |
PDB Entry: 4kdf (more details), 2.36 Å
SCOPe Domain Sequences for d4kdfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdfd2 d.162.1.1 (D:155-326) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgl
Timeline for d4kdfd2:
View in 3D Domains from other chains: (mouse over for more information) d4kdfa1, d4kdfa2, d4kdfb1, d4kdfc1 |