Lineage for d4kdfd2 (4kdf D:155-326)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232793Protein Malate dehydrogenase [56329] (12 species)
  7. 2232875Species Thermus thermophilus [TaxId:274] [82806] (7 PDB entries)
    identical sequence to that from the Thermus flavus enzyme
  8. 2232889Domain d4kdfd2: 4kdf D:155-326 [236587]
    Other proteins in same PDB: d4kdfa1, d4kdfb1, d4kdfc1, d4kdfd1
    automated match to d1wzea2
    complexed with so4

Details for d4kdfd2

PDB Entry: 4kdf (more details), 2.36 Å

PDB Description: Crystal Structure of Thermus thermophilus Malate Dehydrogenase in Complex with NAD
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d4kdfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdfd2 d.162.1.1 (D:155-326) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgl

SCOPe Domain Coordinates for d4kdfd2:

Click to download the PDB-style file with coordinates for d4kdfd2.
(The format of our PDB-style files is described here.)

Timeline for d4kdfd2: