Lineage for d4jmfb_ (4jmf B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445470Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1445471Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 1445541Family d.198.1.0: automated matches [191351] (1 protein)
    not a true family
  6. 1445542Protein automated matches [190293] (3 species)
    not a true protein
  7. 1445543Species Pseudomonas aeruginosa [TaxId:208964] [236548] (1 PDB entry)
  8. 1445544Domain d4jmfb_: 4jmf B: [236550]
    automated match to d1l2wa_
    complexed with gol

Details for d4jmfb_

PDB Entry: 4jmf (more details), 2.1 Å

PDB Description: Crystal structure of ExoT (residues 28 -77)- SpcS complex from Pseudomonas aeruginosa at 2.1 angstrom
PDB Compounds: (B:) Probable chaperone

SCOPe Domain Sequences for d4jmfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jmfb_ d.198.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mnplyraaihqlflaldlptpndeesvlslqvgphlchlaehptdhllmftrlegqgdat
aneqnlfsqdpckpilgrdpesgerllwnrqplqlldraqihhqleqlvaaaeelr

SCOPe Domain Coordinates for d4jmfb_:

Click to download the PDB-style file with coordinates for d4jmfb_.
(The format of our PDB-style files is described here.)

Timeline for d4jmfb_: