Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) |
Family d.198.1.0: automated matches [191351] (1 protein) not a true family |
Protein automated matches [190293] (3 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [236548] (1 PDB entry) |
Domain d4jmfb_: 4jmf B: [236550] automated match to d1l2wa_ complexed with gol |
PDB Entry: 4jmf (more details), 2.1 Å
SCOPe Domain Sequences for d4jmfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jmfb_ d.198.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} mnplyraaihqlflaldlptpndeesvlslqvgphlchlaehptdhllmftrlegqgdat aneqnlfsqdpckpilgrdpesgerllwnrqplqlldraqihhqleqlvaaaeelr
Timeline for d4jmfb_: