Lineage for d4j1la_ (4j1l A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530197Species Clostridium tetani [TaxId:212717] [236546] (1 PDB entry)
  8. 2530198Domain d4j1la_: 4j1l A: [236547]
    automated match to d1f82a_
    complexed with zn; mutant

Details for d4j1la_

PDB Entry: 4j1l (more details), 2.6 Å

PDB Description: mutant endotoxin tent
PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d4j1la_:

Sequence, based on SEQRES records: (download)

>d4j1la_ d.92.1.0 (A:) automated matches {Clostridium tetani [TaxId: 212717]}
pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
pssliegaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgns
yslldkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnenevrgivlrvdnk
nyfpcrdgfgsimqmafcpeyvptfdnvienitsltigkskyfqdpalilmhelihvlhg
lygmqvssheiipskqeiymqhtypisaeelftfggqdanlisidikndlyektlndyka
ianklsqvtscndpnididsykqiyqqkyqfdkdsngqyivnedkfqilynsimygftev
elgkkfniktrlsyfsmnhdpvkipnllddtiyndtegfnieskdlkseykgqnmrvntn
afrnvd

Sequence, based on observed residues (ATOM records): (download)

>d4j1la_ d.92.1.0 (A:) automated matches {Clostridium tetani [TaxId: 212717]}
pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
psseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgnsyslldk
fdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnenevrgivlrvdnknyfpcr
dgfgsimqmafcpeyvptfdnskyfqdpalilmhelihvlhglygmqvsshsaeelftfg
gqdanlisidikndlyektlndykaianklsqvtscndpnididsykqiyqqkyqfdkds
ngqyivnedkfqilynsimygftevelgkkfniktrlsyfsmnhdpvkipnllddtiynd
tegfnieskdlkseykgqnmrvntnafrnvd

SCOPe Domain Coordinates for d4j1la_:

Click to download the PDB-style file with coordinates for d4j1la_.
(The format of our PDB-style files is described here.)

Timeline for d4j1la_: