SCOPe 2.03: Domain d4c74a1: 4c74 A:12-154,A:390-542

Lineage for d4c74a1 (4c74 A:12-154,A:390-542)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Phenylacetone monooxygenase [110440] (1 species)

7. Species Thermobifida fusca [TaxId:2021] [110441] (5 PDB entries)
   Uniprot Q5YS95 # 55% sequence identity; Nocardia farcinica TaxID:37329

8. Domain d4c74a1: 4c74 A:12-154,A:390-542 [236517]
   automated match to d1w4xa1
   complexed with fad, n01, p6g

Details for d4c74a1

PDB Entry: 4c74, 1.97 Å

PDB Description: Phenylacetone monooxygenase: Reduced enzyme in complex with APADP

PDB Compounds: (A:) phenylacetone monooxygenase

SCOPe Domain Sequences for d4c74a1:

Sequence; same for both SEQRES and ATOM records:

>d4c74a1 c.3.1.5 (A:12-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}
qppeevdvlvvgagfsglyalyrlrelgrsvhvietagdvggvwywnrypgarcdiesie
ycysfseevlqewnwteryasqpeilryinfvadkfdlrsgitfhttvtaaafdeatntw
tvdtnhgdrirarylimasgqlsXdaltgalfkidirgvgnvalkekwaagprtylglst
agfpnlffiagpgspsalsnmlvsieqhvewvtdhiaymfkngltrseavlekedewveh
vneiadetlypmtaswytganvpgkprvfmlyvggfhryrqicdevaakgyegfvlt

Timeline for d4c74a1:

• d4c74a1 is new in SCOPe 2.03-stable
  
• d4c74a1 appears in SCOPe 2.04
  
• d4c74a1 appears in the current release, SCOPe 2.08