Lineage for d3zo5b_ (3zo5 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402659Protein automated matches [190118] (8 species)
    not a true protein
  7. 1402675Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries)
  8. 1402730Domain d3zo5b_: 3zo5 B: [236508]
    Other proteins in same PDB: d3zo5a_
    automated match to d2ckhb1

Details for d3zo5b_

PDB Entry: 3zo5 (more details), 2.15 Å

PDB Description: Structure of SENP2-Loop1 in complex with preSUMO-2
PDB Compounds: (B:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d3zo5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zo5b_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvyl

SCOPe Domain Coordinates for d3zo5b_:

Click to download the PDB-style file with coordinates for d3zo5b_.
(The format of our PDB-style files is described here.)

Timeline for d3zo5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3zo5a_