SCOPe 2.03: Domain d3whaa_: 3wha A:

Lineage for d3whaa_ (3wha A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (58 PDB entries)

8. Domain d3whaa_: 3wha A: [236506]
   automated match to d3b26a_
   complexed with gol, mg, wha

Details for d3whaa_

PDB Entry: 3wha, 1.3 Å

PDB Description: Hsp90 alpha N-terminal domain in complex with a tricyclic inhibitor

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3whaa_:

Sequence; same for both SEQRES and ATOM records:

>d3whaa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

Timeline for d3whaa_:

• d3whaa_ is new in SCOPe 2.03-stable
  
• d3whaa_ appears in SCOPe 2.04
  
• d3whaa_ appears in the current release, SCOPe 2.08