SCOPe 2.03: Domain d4manb_: 4man B:

Lineage for d4manb_ (4man B:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 [64524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64525] (9 PDB entries)

8. Domain d4manb_: 4man B: [236461]
   automated match to d1gjha_
   complexed with 1y1

Details for d4manb_

PDB Entry: 4man, 2.07 Å

PDB Description: bcl_2-navitoclax analog (with indole) complex

PDB Compounds: (B:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d4manb_:

Sequence, based on SEQRES records:

>d4manb_ f.1.4.1 (B:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
gydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagddfsrry
rrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsp
lvdnialwmteylnrhlhtwiqdnggwdafvelygp

Sequence, based on observed residues (ATOM records):

>d4manb_ f.1.4.1 (B:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
gydnreivmkyihyklsqrgyeevvhltlrqagddfsrryrrdfaemssqlhltpftarg
rfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteylnrhlhtw
iqdnggwdafvelygp

Timeline for d4manb_:

• d4manb_ is new in SCOPe 2.03-stable
  
• d4manb_ appears in SCOPe 2.04
  
• d4manb_ appears in the current release, SCOPe 2.08