SCOPe 2.08: Domain d4lpwa1: 4lpw A:2-92

Lineage for d4lpwa1 (4lpw A:2-92)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)

8. Domain d4lpwa1: 4lpw A:2-92 [236449]
   Other proteins in same PDB: d4lpwa2, d4lpwb2
   automated match to d1tena_

Details for d4lpwa1

PDB Entry: 4lpw, 2.8 Å

PDB Description: Crystal structure of TENCON variant A6

PDB Compounds: (A:) TENCON variant A6

SCOPe Domain Sequences for d4lpwa1:

Sequence; same for both SEQRES and ATOM records:

>d4lpwa1 b.1.2.0 (A:2-92) automated matches {Artificial gene [TaxId: 32630]}
lpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltg
lkpgteytvsiygvfpyqytmsnplsaeftt

Timeline for d4lpwa1:

• d4lpwa1 first appeared in SCOPe 2.03, called d4lpwa_
  
• d4lpwa1 appears in SCOPe 2.07