SCOPe 2.08: Domain d4lpyb1: 4lpy B:3-93

Lineage for d4lpyb1 (4lpy B:3-93)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)

8. Domain d4lpyb1: 4lpy B:3-93 [236447]
   Other proteins in same PDB: d4lpya2, d4lpyb2
   automated match to d1tena_
   complexed with na

Details for d4lpyb1

PDB Entry: 4lpy, 1.92 Å

PDB Description: Crystal structure of TENCON variant G10

PDB Compounds: (B:) TENCON variant G10

SCOPe Domain Sequences for d4lpyb1:

Sequence; same for both SEQRES and ATOM records:

>d4lpyb1 b.1.2.0 (B:3-93) automated matches {Artificial gene [TaxId: 32630]}
papknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltgl
kpgteytvsiygvfmkmslsksnplsaeftt

Timeline for d4lpyb1:

• d4lpyb1 first appeared in SCOPe 2.03, called d4lpyb_
  
• d4lpyb1 appears in SCOPe 2.07