SCOPe 2.05: Domain d4lpya_: 4lpy A:

Lineage for d4lpya_ (4lpy A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)

8. Domain d4lpya_: 4lpy A: [236446]
   automated match to d1tena_
   complexed with na

Details for d4lpya_

PDB Entry: 4lpy, 1.92 Å

PDB Description: Crystal structure of TENCON variant G10

PDB Compounds: (A:) TENCON variant G10

SCOPe Domain Sequences for d4lpya_:

Sequence; same for both SEQRES and ATOM records:

>d4lpya_ b.1.2.0 (A:) automated matches {Artificial gene [TaxId: 32630]}
lpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltg
lkpgteytvsiygvfmkmslsksnplsaefttgghhh

Timeline for d4lpya_:

• d4lpya_ first appeared in SCOPe 2.03
  
• d4lpya_ appears in SCOPe 2.04
  
• d4lpya_ is called d4lpya1 in SCOPe 2.06
  
• d4lpya_ appears in the current release, SCOPe 2.08, called d4lpya1