Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (4 species) not a true protein |
Species Artificial gene [TaxId:32630] [233328] (6 PDB entries) |
Domain d4lpva1: 4lpv A:1-91 [236445] Other proteins in same PDB: d4lpva2, d4lpvb2 automated match to d2cuma1 complexed with trs |
PDB Entry: 4lpv (more details), 1.8 Å
SCOPe Domain Sequences for d4lpva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpva1 b.1.2.0 (A:1-91) automated matches {Artificial gene [TaxId: 32630]} mlpapknlvvsevtedslrlswtapdaafdsfmiqyqesekvgeainltvpgsersydlt glkpgteytvsiygvlvvhkltfplsaeftt
Timeline for d4lpva1: