Lineage for d1lpbb1 (1lpb B:337-449)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776643Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 1776644Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 1776679Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
    automatically mapped to Pfam PF01477
  6. 1776680Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 1776688Species Human (Homo sapiens) [TaxId:9606] [49734] (3 PDB entries)
  8. 1776689Domain d1lpbb1: 1lpb B:337-449 [23643]
    Other proteins in same PDB: d1lpba1, d1lpba2, d1lpbb2
    complexed with bog, ca, mup

Details for d1lpbb1

PDB Entry: 1lpb (more details), 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate
PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1lpbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpbb1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc

SCOPe Domain Coordinates for d1lpbb1:

Click to download the PDB-style file with coordinates for d1lpbb1.
(The format of our PDB-style files is described here.)

Timeline for d1lpbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpbb2