| Class b: All beta proteins [48724] (180 folds) |
| Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) ![]() |
| Family b.12.1.2: Colipase-binding domain [49730] (1 protein) automatically mapped to Pfam PF01477 |
| Protein Pancreatic lipase, C-terminal domain [49731] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49734] (3 PDB entries) |
| Domain d1lpbb1: 1lpb B:337-449 [23643] Other proteins in same PDB: d1lpba1, d1lpba2, d1lpbb2 complexed with bog, ca, mup |
PDB Entry: 1lpb (more details), 2.46 Å
SCOPe Domain Sequences for d1lpbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpbb1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc
Timeline for d1lpbb1: