Lineage for d4iyaa_ (4iya A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1455550Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1455551Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 1455652Family f.6.1.0: automated matches [227293] (1 protein)
    not a true family
  6. 1455653Protein automated matches [227114] (2 species)
    not a true protein
  7. 1455657Species Staphylococcus phage [TaxId:71366] [236419] (5 PDB entries)
  8. 1455658Domain d4iyaa_: 4iya A: [236421]
    automated match to d3lkfa_
    complexed with edo, flc; mutant

Details for d4iyaa_

PDB Entry: 4iya (more details), 1.55 Å

PDB Description: structure of the y250a mutant of the panton-valentine leucocidin s component from staphylococcus aureus
PDB Compounds: (A:) LukS-PV

SCOPe Domain Sequences for d4iyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iyaa_ f.6.1.0 (A:) automated matches {Staphylococcus phage [TaxId: 71366]}
nnienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyy
nykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgp
stggngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgy
kpysqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatr
rtthygnsalegsrihnafvnrnytvkyevnwktheikvkghn

SCOPe Domain Coordinates for d4iyaa_:

Click to download the PDB-style file with coordinates for d4iyaa_.
(The format of our PDB-style files is described here.)

Timeline for d4iyaa_: