| Class b: All beta proteins [48724] (180 folds) |
| Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) ![]() |
| Family b.12.1.2: Colipase-binding domain [49730] (1 protein) automatically mapped to Pfam PF01477 |
| Protein Pancreatic lipase, C-terminal domain [49731] (6 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [49733] (1 PDB entry) |
| Domain d1ethc1: 1eth C:337-448 [23642] Other proteins in same PDB: d1etha2, d1ethb1, d1ethb2, d1ethc2, d1ethd1, d1ethd2 complexed with bme, c8e, ca |
PDB Entry: 1eth (more details), 2.8 Å
SCOPe Domain Sequences for d1ethc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ethc1 b.12.1.2 (C:337-448) Pancreatic lipase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
arwrykvsvtlsgkkvtghilvslfgnegnsrqyeiykgtlqpdnthsdefdsdvevgdl
qkvkfiwynvinptlprvgaskitverndgkvydfcsqetvreevlltlnpc
Timeline for d1ethc1: