Lineage for d1etha1 (1eth A:337-448)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045908Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2045909Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2045956Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
    automatically mapped to Pfam PF01477
  6. 2045957Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 2045971Species Pig (Sus scrofa) [TaxId:9823] [49733] (1 PDB entry)
  8. 2045972Domain d1etha1: 1eth A:337-448 [23641]
    Other proteins in same PDB: d1etha2, d1ethb1, d1ethb2, d1ethc2, d1ethd1, d1ethd2
    complexed with bme, c8e, ca

Details for d1etha1

PDB Entry: 1eth (more details), 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex
PDB Compounds: (A:) triacylglycerol acyl-hydrolase

SCOPe Domain Sequences for d1etha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etha1 b.12.1.2 (A:337-448) Pancreatic lipase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
arwrykvsvtlsgkkvtghilvslfgnegnsrqyeiykgtlqpdnthsdefdsdvevgdl
qkvkfiwynvinptlprvgaskitverndgkvydfcsqetvreevlltlnpc

SCOPe Domain Coordinates for d1etha1:

Click to download the PDB-style file with coordinates for d1etha1.
(The format of our PDB-style files is described here.)

Timeline for d1etha1: