SCOPe 2.03: Domain d4ckoc2: 4cko C:445-531

Lineage for d4ckoc2 (4cko C:445-531)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (18 PDB entries)

8. Domain d4ckoc2: 4cko C:445-531 [236317]
   Other proteins in same PDB: d4ckoa1, d4ckob1, d4ckoc1, d4ckod1, d4ckoe1, d4ckof1, d4ckog1, d4ckoh1
   automated match to d2adca2
   complexed with cl, zn

Details for d4ckoc2

PDB Entry: 4cko, 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB

PDB Compounds: (C:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckoc2:

Sequence; same for both SEQRES and ATOM records:

>d4ckoc2 d.58.7.0 (C:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

Timeline for d4ckoc2:

• d4ckoc2 is new in SCOPe 2.03-stable
  
• d4ckoc2 does not appear in SCOPe 2.04