SCOPe 2.03: Domain d4ckog1: 4cko G:337-444

Lineage for d4ckog1 (4cko G:337-444)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (13 PDB entries)

8. Domain d4ckog1: 4cko G:337-444 [236312]
   Other proteins in same PDB: d4ckob2, d4ckoc2, d4ckod2, d4ckoe2, d4ckof2, d4ckog2, d4ckoh2
   automated match to d1qm9a1
   complexed with cl, zn

Details for d4ckog1

PDB Entry: 4cko, 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB

PDB Compounds: (G:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckog1:

Sequence, based on SEQRES records:

>d4ckog1 d.58.7.1 (G:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs

Sequence, based on observed residues (ATOM records):

>d4ckog1 d.58.7.1 (G:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgs

Timeline for d4ckog1:

• d4ckog1 is new in SCOPe 2.03-stable
  
• d4ckog1 does not appear in SCOPe 2.04