Lineage for d4c8ec_ (4c8e C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1421248Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1421365Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 1421366Protein automated matches [190884] (4 species)
    not a true protein
  7. 1421367Species Burkholderia cenocepacia [TaxId:216591] [235915] (3 PDB entries)
  8. 1421373Domain d4c8ec_: 4c8e C: [236298]
    automated match to d4c8gc_
    complexed with c5p, peg, so4, zn

Details for d4c8ec_

PDB Entry: 4c8e (more details), 1.9 Å

PDB Description: ispf (burkholderia cenocepacia) 2cmp complex
PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d4c8ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c8ec_ d.79.5.0 (C:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mdvrigqgydvhqlvegrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdaafkgadsrvllracaervkaagftiqnvdstviaqapklaphidgmraniaa
dlglplervnvkaktneklgylgrgegieaqaaallvkqgg

SCOPe Domain Coordinates for d4c8ec_:

Click to download the PDB-style file with coordinates for d4c8ec_.
(The format of our PDB-style files is described here.)

Timeline for d4c8ec_: